SCOP 1.71: Domain d1ck4b_: 1ck4 B:

Lineage for d1ck4b_ (1ck4 B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (4 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)

6. Protein Integrin alpha1-beta1 [53310] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [53312] (2 PDB entries)

8. Domain d1ck4b_: 1ck4 B: [34150]

Details for d1ck4b_

PDB Entry: 1ck4, 2.2 Å

PDB Description: crystal structure of rat a1b1 integrin i-domain.

SCOP Domain Sequences for d1ck4b_:

Sequence; same for both SEQRES and ATOM records:

>d1ck4b_ c.62.1.1 (B:) Integrin alpha1-beta1 {Rat (Rattus norvegicus)}
tqldivivldgsnsiypwesviaflndllkrmdigpkqtqvgivqygenvthefnlnkys
steevlvaankigrqgglqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdny
rlkqviqdcedeniqrfsiailghynrgnlstekfveeiksiaseptekhffnvsdelal
vtivkalgerifale

Timeline for d1ck4b_:

• d1ck4b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ck4b_ appears in SCOP 1.69
  
• d1ck4b_ appears in SCOP 1.73
  
• d1ck4b_ appears in the current release, SCOPe 2.08