Lineage for d1ck4b_ (1ck4 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72868Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 72869Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 72870Family c.62.1.1: Integrin A (or I) domain [53301] (6 proteins)
  6. 72871Protein Integrin alpha1-beta1 [53310] (2 species)
  7. 72875Species Rat (Rattus norvegicus) [TaxId:10116] [53312] (1 PDB entry)
  8. 72877Domain d1ck4b_: 1ck4 B: [34150]

Details for d1ck4b_

PDB Entry: 1ck4 (more details), 2.2 Å

PDB Description: crystal structure of rat a1b1 integrin i-domain.

SCOP Domain Sequences for d1ck4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck4b_ c.62.1.1 (B:) Integrin alpha1-beta1 {Rat (Rattus norvegicus)}
tqldivivldgsnsiypwesviaflndllkrmdigpkqtqvgivqygenvthefnlnkys
steevlvaankigrqgglqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdny
rlkqviqdcedeniqrfsiailghynrgnlstekfveeiksiaseptekhffnvsdelal
vtivkalgerifale

SCOP Domain Coordinates for d1ck4b_:

Click to download the PDB-style file with coordinates for d1ck4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ck4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ck4a_