SCOPe 2.06: Domain d5lefa_: 5lef A:

Lineage for d5lefa_ (5lef A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)

8. Domain d5lefa_: 5lef A: [341498]
   automated match to d2bcgy_
   complexed with gol, gtp, ipa, mg, so4

Details for d5lefa_

PDB Entry: 5lef, 2.09 Å

PDB Description: rab6a:kif20a complex

PDB Compounds: (A:) Ras-related protein Rab-6A

SCOPe Domain Sequences for d5lefa_:

Sequence; same for both SEQRES and ATOM records:

>d5lefa_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdta
glerfrslipsyirdstvavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdl
adkrqvsieegerkakelnvmfietsakagynvkqlfrrvaaalpg

Timeline for d5lefa_:

• d5lefa_ is new in SCOPe 2.06-stable
  
• d5lefa_ appears in SCOPe 2.07
  
• d5lefa_ appears in the current release, SCOPe 2.08