Lineage for d5k4va1 (5k4v A:1003-1321)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2109198Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226760] (20 PDB entries)
  8. 2109262Domain d5k4va1: 5k4v A:1003-1321 [341495]
    Other proteins in same PDB: d5k4va2, d5k4vc2
    automated match to d4yrab_
    complexed with act, gol, na, nad

Details for d5k4va1

PDB Entry: 5k4v (more details), 2.2 Å

PDB Description: three-dimensional structure of l-threonine 3-dehydrogenase from trypanosoma brucei bound to nad+ refined to 2.2 angstroms
PDB Compounds: (A:) L-threonine 3-dehydrogenase

SCOPe Domain Sequences for d5k4va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k4va1 c.2.1.0 (A:1003-1321) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf
eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa
fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg
ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni
tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid
mmsedmlrqipilhglpsl

SCOPe Domain Coordinates for d5k4va1:

Click to download the PDB-style file with coordinates for d5k4va1.
(The format of our PDB-style files is described here.)

Timeline for d5k4va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5k4va2