Lineage for d1ck4a_ (1ck4 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125459Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 125460Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 125461Family c.62.1.1: Integrin A (or I) domain [53301] (7 proteins)
  6. 125462Protein Integrin alpha1-beta1 [53310] (2 species)
  7. 125466Species Rat (Rattus norvegicus) [TaxId:10116] [53312] (1 PDB entry)
  8. 125467Domain d1ck4a_: 1ck4 A: [34149]

Details for d1ck4a_

PDB Entry: 1ck4 (more details), 2.2 Å

PDB Description: crystal structure of rat a1b1 integrin i-domain.

SCOP Domain Sequences for d1ck4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck4a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Rat (Rattus norvegicus)}
tqldivivldgsnsiypwesviaflndllkrmdigpkqtqvgivqygenvthefnlnkys
steevlvaankigrqgglqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdny
rlkqviqdcedeniqrfsiailghynrgnlstekfveeiksiaseptekhffnvsdelal
vtivkalgerifa

SCOP Domain Coordinates for d1ck4a_:

Click to download the PDB-style file with coordinates for d1ck4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ck4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ck4b_