Lineage for d1qc5b_ (1qc5 B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125459Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 125460Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 125461Family c.62.1.1: Integrin A (or I) domain [53301] (7 proteins)
  6. 125462Protein Integrin alpha1-beta1 [53310] (2 species)
  7. 125463Species Human (Homo sapiens) [TaxId:9606] [53311] (1 PDB entry)
  8. 125465Domain d1qc5b_: 1qc5 B: [34148]

Details for d1qc5b_

PDB Entry: 1qc5 (more details), 2 Å

PDB Description: i domain from integrin alpha1-beta1

SCOP Domain Sequences for d1qc5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qc5b_ c.62.1.1 (B:) Integrin alpha1-beta1 {Human (Homo sapiens)}
qldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnkyss
teevlvaakkivqrggrqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdnhr
lkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdeialv
tivktlgeri

SCOP Domain Coordinates for d1qc5b_:

Click to download the PDB-style file with coordinates for d1qc5b_.
(The format of our PDB-style files is described here.)

Timeline for d1qc5b_: