SCOPe 2.08: Domain d1qc5b_: 1qc5 B:

Lineage for d1qc5b_ (1qc5 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)

6. Protein Integrin alpha1-beta1 [53310] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53311] (4 PDB entries)

8. Domain d1qc5b_: 1qc5 B: [34148]
   complexed with mg

Details for d1qc5b_

PDB Entry: 1qc5, 2 Å

PDB Description: i domain from integrin alpha1-beta1

PDB Compounds: (B:) protein (alpha1 beta1 integrin)

SCOPe Domain Sequences for d1qc5b_:

Sequence; same for both SEQRES and ATOM records:

>d1qc5b_ c.62.1.1 (B:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]}
qldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnkyss
teevlvaakkivqrggrqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdnhr
lkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdeialv
tivktlgeri

Timeline for d1qc5b_:

• d1qc5b_ first appeared (with stable ids) in SCOP 1.55
  
• d1qc5b_ appears in SCOPe 2.07