Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
Protein Integrin alpha1-beta1 [53310] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [53311] (4 PDB entries) |
Domain d1qc5b_: 1qc5 B: [34148] complexed with mg |
PDB Entry: 1qc5 (more details), 2 Å
SCOPe Domain Sequences for d1qc5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qc5b_ c.62.1.1 (B:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} qldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnkyss teevlvaakkivqrggrqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdnhr lkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdeialv tivktlgeri
Timeline for d1qc5b_: