Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226760] (22 PDB entries) |
Domain d5k4qa1: 5k4q A:1003-1321 [341479] Other proteins in same PDB: d5k4qa2, d5k4qd2 automated match to d4yrab_ complexed with gol, nad, so4 |
PDB Entry: 5k4q (more details), 2.3 Å
SCOPe Domain Sequences for d5k4qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k4qa1 c.2.1.0 (A:1003-1321) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid mmsedmlrqipilhglpsl
Timeline for d5k4qa1: