Lineage for d1qc5a_ (1qc5 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25985Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 25986Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 25987Family c.62.1.1: Integrin A (or I) domain [53301] (6 proteins)
  6. 25988Protein Integrin alpha1-beta1 [53310] (2 species)
  7. 25989Species Human (Homo sapiens) [TaxId:9606] [53311] (1 PDB entry)
  8. 25990Domain d1qc5a_: 1qc5 A: [34147]

Details for d1qc5a_

PDB Entry: 1qc5 (more details), 2 Å

PDB Description: i domain from integrin alpha1-beta1

SCOP Domain Sequences for d1qc5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qc5a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens)}
stqldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnky
ssteevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdn
hrlkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdeia
lvtivktlgeri

SCOP Domain Coordinates for d1qc5a_:

Click to download the PDB-style file with coordinates for d1qc5a_.
(The format of our PDB-style files is described here.)

Timeline for d1qc5a_: