Lineage for d5h6oa1 (5h6o A:10-225)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2163017Protein automated matches [190140] (30 species)
    not a true protein
  7. 2163245Species Vibrio cholerae [TaxId:666] [341466] (1 PDB entry)
  8. 2163246Domain d5h6oa1: 5h6o A:10-225 [341467]
    Other proteins in same PDB: d5h6oa2
    automated match to d1pdaa1
    complexed with dpm, mg

Details for d5h6oa1

PDB Entry: 5h6o (more details), 2.7 Å

PDB Description: porphobilinogen deaminase from vibrio cholerae
PDB Compounds: (A:) porphobilinogen deaminase

SCOPe Domain Sequences for d5h6oa1:

Sequence, based on SEQRES records: (download)

>d5h6oa1 c.94.1.1 (A:10-225) automated matches {Vibrio cholerae [TaxId: 666]}
tpiriatrqsplalwqanyvkdalmaahpglqvelvtmvtrgdvildtplakvggkglfv
keleiamlegradlavhsmkdvpvdfpdglglvticeredprdafvsntyakiedlpsga
ivgtcslrrqcqlkaarpdlvikelrgnvgtrlskldageydaiilaaaglkrlelesri
rsfiepeqslpavgqgavgiecrvndqrvrallapl

Sequence, based on observed residues (ATOM records): (download)

>d5h6oa1 c.94.1.1 (A:10-225) automated matches {Vibrio cholerae [TaxId: 666]}
tpiriatrqsplalwqanyvkdalmaahpglqvelvtmvfvkeleiamlegradlavhsm
kdvpvdfpdglglvticeredprdafvsntyakiedlpsgaivgtcslrrqcqlkaarpd
lvikelrgnvgtrlskldageydaiilaaaglkrlelesrirsfiepeqslpavgqgavg
iecrvndqrvrallapl

SCOPe Domain Coordinates for d5h6oa1:

Click to download the PDB-style file with coordinates for d5h6oa1.
(The format of our PDB-style files is described here.)

Timeline for d5h6oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5h6oa2