Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein automated matches [190140] (30 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [341466] (1 PDB entry) |
Domain d5h6oa1: 5h6o A:10-225 [341467] Other proteins in same PDB: d5h6oa2 automated match to d1pdaa1 complexed with dpm, mg |
PDB Entry: 5h6o (more details), 2.7 Å
SCOPe Domain Sequences for d5h6oa1:
Sequence, based on SEQRES records: (download)
>d5h6oa1 c.94.1.1 (A:10-225) automated matches {Vibrio cholerae [TaxId: 666]} tpiriatrqsplalwqanyvkdalmaahpglqvelvtmvtrgdvildtplakvggkglfv keleiamlegradlavhsmkdvpvdfpdglglvticeredprdafvsntyakiedlpsga ivgtcslrrqcqlkaarpdlvikelrgnvgtrlskldageydaiilaaaglkrlelesri rsfiepeqslpavgqgavgiecrvndqrvrallapl
>d5h6oa1 c.94.1.1 (A:10-225) automated matches {Vibrio cholerae [TaxId: 666]} tpiriatrqsplalwqanyvkdalmaahpglqvelvtmvfvkeleiamlegradlavhsm kdvpvdfpdglglvticeredprdafvsntyakiedlpsgaivgtcslrrqcqlkaarpd lvikelrgnvgtrlskldageydaiilaaaglkrlelesrirsfiepeqslpavgqgavg iecrvndqrvrallapl
Timeline for d5h6oa1: