SCOPe 2.04: Domain d1bhq2_: 1bhq 2:

Lineage for d1bhq2_ (1bhq 2:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)

6. Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53309] (11 PDB entries)

8. Domain d1bhq2_: 1bhq 2: [34146]
   complexed with ace, cd

Details for d1bhq2_

PDB Entry: 1bhq, 2.7 Å

PDB Description: mac-1 i domain cadmium complex

PDB Compounds: (2:) cd11b

SCOPe Domain Sequences for d1bhq2_:

Sequence; same for both SEQRES and ATOM records:

>d1bhq2_ c.62.1.1 (2:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
rekifaieg

Timeline for d1bhq2_:

• d1bhq2_ first appeared (with stable ids) in SCOP 1.55
  
• d1bhq2_ appears in SCOPe 2.03
  
• d1bhq2_ appears in SCOPe 2.05
  
• d1bhq2_ appears in the current release, SCOPe 2.08