Lineage for d6b08b1 (6b08 B:1-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756788Domain d6b08b1: 6b08 B:1-108 [341454]
    Other proteins in same PDB: d6b08b2
    automated match to d1lila1
    complexed with gol

Details for d6b08b1

PDB Entry: 6b08 (more details), 2.2 Å

PDB Description: crystal structure of pfs25 in complex with the transmission blocking antibody 1276
PDB Compounds: (B:) 1276 antibody, light chain

SCOPe Domain Sequences for d6b08b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b08b1 b.1.1.0 (B:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syvltqppsvsvapgktakitcggnnigsksvhwyqqkpgqapvlvmyydfdrpsgiper
fsgsnsgntatltisrveaedeadyycqvwdsdrywvfgggtkltvlg

SCOPe Domain Coordinates for d6b08b1:

Click to download the PDB-style file with coordinates for d6b08b1.
(The format of our PDB-style files is described here.)

Timeline for d6b08b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b08b2
View in 3D
Domains from other chains:
(mouse over for more information)
d6b08c_