SCOPe 2.06: Domain d6b0al1: 6b0a L:1-104

Lineage for d6b0al1 (6b0a L:1-104)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)

8. Domain d6b0al1: 6b0a L:1-104 [341453]
   Other proteins in same PDB: d6b0al2
   automated match to d1dn0a1
   complexed with gol

Details for d6b0al1

PDB Entry: 6b0a, 2.5 Å

PDB Description: crystal structure of pfs25 in complex with the transmission blocking antibody 1269

PDB Compounds: (L:) 1269 antibody, light chain

SCOPe Domain Sequences for d6b0al1:

Sequence; same for both SEQRES and ATOM records:

>d6b0al1 b.1.1.1 (L:1-104) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrtsqsvsssylawyqqkpgqaprllmygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygnsfgqgtrlei

Timeline for d6b0al1:

• d6b0al1 is new in SCOPe 2.06-stable
  
• d6b0al1 appears in SCOPe 2.07
  
• d6b0al1 appears in the current release, SCOPe 2.08