Lineage for d5vmfe_ (5vmf E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047955Protein automated matches [190291] (25 species)
    not a true protein
  7. 2048048Species Influenza a virus (strain a/brevig mission/1/1918 h1n1) [TaxId:88776] [341379] (2 PDB entries)
  8. 2048054Domain d5vmfe_: 5vmf E: [341445]
    Other proteins in same PDB: d5vmfb_, d5vmfd_, d5vmff_
    automated match to d3ztna_
    complexed with bma, gal, nag, sia; mutant

Details for d5vmfe_

PDB Entry: 5vmf (more details), 2.35 Å

PDB Description: influenza hemagglutinin h1 mutant dh1d in complex with 6'sln
PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d5vmfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vmfe_ b.19.1.2 (E:) automated matches {Influenza a virus (strain a/brevig mission/1/1918 h1n1) [TaxId: 88776]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvhh
pptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdlasrmnyywtllepgdtit
featgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvtig
ecpkyvrstklrmatglrnip

SCOPe Domain Coordinates for d5vmfe_:

Click to download the PDB-style file with coordinates for d5vmfe_.
(The format of our PDB-style files is described here.)

Timeline for d5vmfe_: