Lineage for d1bho2_ (1bho 2:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500013Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2500014Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2500015Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2500028Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species)
  7. 2500029Species Human (Homo sapiens) [TaxId:9606] [53309] (12 PDB entries)
  8. 2500038Domain d1bho2_: 1bho 2: [34144]
    complexed with mg

Details for d1bho2_

PDB Entry: 1bho (more details), 2.7 Å

PDB Description: mac-1 i domain magnesium complex
PDB Compounds: (2:) cd11b

SCOPe Domain Sequences for d1bho2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bho2_ c.62.1.1 (2:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
rekifaieg

SCOPe Domain Coordinates for d1bho2_:

Click to download the PDB-style file with coordinates for d1bho2_.
(The format of our PDB-style files is described here.)

Timeline for d1bho2_: