SCOPe 2.06: Domain d5vleb_: 5vle B:

Lineage for d5vleb_ (5vle B:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (66 PDB entries)

8. Domain d5vleb_: 5vle B: [341434]
   automated match to d4ua6a_
   complexed with jsc, jsd, jse, k, po4, ru

Details for d5vleb_

PDB Entry: 5vle, 0.85 Å

PDB Description: ultrahigh resolution x-ray crystal structure of ruthenocene conjugated penicilloate and penilloate products in complex with ctx-m-14 e166a beta-lactamase

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5vleb_:

Sequence; same for both SEQRES and ATOM records:

>d5vleb_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
avqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetqk
qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
tafaraigdetfrldrtaptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
twlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpqq
naesrrdvlasaariiaegl

Timeline for d5vleb_:

• d5vleb_ is new in SCOPe 2.06-stable
  
• d5vleb_ appears in SCOPe 2.07
  
• d5vleb_ appears in the current release, SCOPe 2.08