Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Dengue virus 4 [TaxId:11070] [341429] (1 PDB entry) |
Domain d5xc7a2: 5xc7 A:483-618 [341430] Other proteins in same PDB: d5xc7a1, d5xc7a3 automated match to d2jlsa2 complexed with cl, gol; mutant |
PDB Entry: 5xc7 (more details), 2.1 Å
SCOPe Domain Sequences for d5xc7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xc7a2 c.37.1.0 (A:483-618) automated matches {Dengue virus 4 [TaxId: 11070]} edhahwteakmlldniytpegiiptlfgperektqaidgefrlrgeqrktfvelmrrgdl pvwlsykvasagisykdrewcftgernnqileenmeveiwtregekkklrpkwldarvya dpmalkdfkefasgrk
Timeline for d5xc7a2: