Lineage for d5xc7a2 (5xc7 A:483-618)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871836Species Dengue virus 4 [TaxId:11070] [341429] (1 PDB entry)
  8. 2871837Domain d5xc7a2: 5xc7 A:483-618 [341430]
    Other proteins in same PDB: d5xc7a1, d5xc7a3
    automated match to d2jlsa2
    complexed with cl, gol; mutant

Details for d5xc7a2

PDB Entry: 5xc7 (more details), 2.1 Å

PDB Description: dengue virus 4 ns3 helicase d290a mutant
PDB Compounds: (A:) NS3 helicase

SCOPe Domain Sequences for d5xc7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xc7a2 c.37.1.0 (A:483-618) automated matches {Dengue virus 4 [TaxId: 11070]}
edhahwteakmlldniytpegiiptlfgperektqaidgefrlrgeqrktfvelmrrgdl
pvwlsykvasagisykdrewcftgernnqileenmeveiwtregekkklrpkwldarvya
dpmalkdfkefasgrk

SCOPe Domain Coordinates for d5xc7a2:

Click to download the PDB-style file with coordinates for d5xc7a2.
(The format of our PDB-style files is described here.)

Timeline for d5xc7a2: