Lineage for d1bho1_ (1bho 1:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25985Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 25986Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 25987Family c.62.1.1: Integrin A (or I) domain [53301] (6 proteins)
  6. 26011Protein Integrin CR3 (CD11b/CD18, Mac-1), alpha subunit [53308] (1 species)
  7. 26012Species Human (Homo sapiens) [TaxId:9606] [53309] (5 PDB entries)
  8. 26017Domain d1bho1_: 1bho 1: [34143]

Details for d1bho1_

PDB Entry: 1bho (more details), 2.7 Å

PDB Description: mac-1 i domain magnesium complex

SCOP Domain Sequences for d1bho1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bho1_ c.62.1.1 (1:) Integrin CR3 (CD11b/CD18, Mac-1), alpha subunit {Human (Homo sapiens)}
sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
rekifaieg

SCOP Domain Coordinates for d1bho1_:

Click to download the PDB-style file with coordinates for d1bho1_.
(The format of our PDB-style files is described here.)

Timeline for d1bho1_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bho2_