SCOPe 2.08: Domain d1bho1_: 1bho 1:

Lineage for d1bho1_ (1bho 1:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)

6. Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53309] (13 PDB entries)

8. Domain d1bho1_: 1bho 1: [34143]
   complexed with mg

Details for d1bho1_

PDB Entry: 1bho, 2.7 Å

PDB Description: mac-1 i domain magnesium complex

PDB Compounds: (1:) cd11b

SCOPe Domain Sequences for d1bho1_:

Sequence; same for both SEQRES and ATOM records:

>d1bho1_ c.62.1.1 (1:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
rekifaieg

Timeline for d1bho1_:

• d1bho1_ first appeared (with stable ids) in SCOP 1.55
  
• d1bho1_ appears in SCOPe 2.07