SCOPe 2.06: Domain d5xv8b1: 5xv8 B:2-108

Lineage for d5xv8b1 (5xv8 B:2-108)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.9: TFIIH domain [110272] (2 proteins)

6. Protein TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain [110273] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110274] (5 PDB entries)
   Uniprot P32780 1-108

8. Domain d5xv8b1: 5xv8 B:2-108 [341424]
   Other proteins in same PDB: d5xv8b2
   automated match to d2rukb_
   protein/DNA complex

Details for d5xv8b1

PDB Entry: 5xv8

PDB Description: solution structure of the complex between uvssa acidic region and tfiih p62 ph domain

PDB Compounds: (B:) General transcription factor IIH subunit 1

SCOPe Domain Sequences for d5xv8b1:

Sequence; same for both SEQRES and ATOM records:

>d5xv8b1 b.55.1.9 (B:2-108) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
atsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegka
kiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan

Timeline for d5xv8b1:

• d5xv8b1 is new in SCOPe 2.06-stable
  
• d5xv8b1 appears in SCOPe 2.07
  
• d5xv8b1 appears in the current release, SCOPe 2.08