Lineage for d5vlea_ (5vle A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2569281Protein automated matches [190161] (27 species)
    not a true protein
  7. 2569346Species Escherichia coli [TaxId:562] [187306] (77 PDB entries)
  8. 2569354Domain d5vlea_: 5vle A: [341418]
    automated match to d4ua6a_
    complexed with jsc, jsd, jse, k, po4, ru

Details for d5vlea_

PDB Entry: 5vle (more details), 0.85 Å

PDB Description: ultrahigh resolution x-ray crystal structure of ruthenocene conjugated penicilloate and penilloate products in complex with ctx-m-14 e166a beta-lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5vlea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vlea_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
etsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrtaptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq
pqqnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d5vlea_:

Click to download the PDB-style file with coordinates for d5vlea_.
(The format of our PDB-style files is described here.)

Timeline for d5vlea_: