Lineage for d5vmjf_ (5vmj F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3041801Species Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [341366] (4 PDB entries)
  8. 3041813Domain d5vmjf_: 5vmj F: [341413]
    Other proteins in same PDB: d5vmja_, d5vmjc_, d5vmje_
    automated match to d5bnyf_
    complexed with nag; mutant

Details for d5vmjf_

PDB Entry: 5vmj (more details), 2.95 Å

PDB Description: influenza hemagglutinin h1 mutant dh1e in complex with 3'sln
PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d5vmjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vmjf_ h.3.1.0 (F:) automated matches {Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyse

SCOPe Domain Coordinates for d5vmjf_:

Click to download the PDB-style file with coordinates for d5vmjf_.
(The format of our PDB-style files is described here.)

Timeline for d5vmjf_: