Lineage for d1idn1_ (1idn 1:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.62: vWA-like [53299] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the restSuperfamily c.62.1: vWA-like [53300] (6 families) 
Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species) Species Human (Homo sapiens) [TaxId:9606] [53309] (13 PDB entries) 
Domain d1idn1_: 1idn 1: [34141]
Details for d1idn1_
PDB Entry: 1idn (more details), 2.7 Å
PDB Description: mac-1 i domain metal free
PDB Compounds: (1:) cd11bSCOPe Domain Sequences for d1idn1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1idn1_ c.62.1.1 (1:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
rekifaieg
SCOPe Domain Coordinates for d1idn1_:
Click to download the PDB-style file with coordinates for d1idn1_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1idn1_:
- d1idn1_ first appeared (with stable ids) in SCOP 1.55
- d1idn1_ appears in SCOPe 2.07
View in 3D
