SCOPe 2.06: Domain d5xqma_: 5xqm A:

Lineage for d5xqma_ (5xqm A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255480] (4 PDB entries)

8. Domain d5xqma_: 5xqm A: [341409]
   automated match to d2k1fa_

Details for d5xqma_

PDB Entry: 5xqm

PDB Description: nmr solution structure of smo1, sumo homologue in caenorhabditis elegans

PDB Compounds: (A:) Small ubiquitin-related modifier

SCOPe Domain Sequences for d5xqma_:

Sequence; same for both SEQRES and ATOM records:

>d5xqma_ d.15.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
maddaaqagdnaeyikikvvgqdsnevhfrvkygtsmaklkksyadrtgvavnslrflfd
grrindddtpktlemedddvievyqeqlgg

Timeline for d5xqma_:

• d5xqma_ is new in SCOPe 2.06-stable
  
• d5xqma_ appears in SCOPe 2.07
  
• d5xqma_ appears in the current release, SCOPe 2.08