Lineage for d5xqma_ (5xqm A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502871Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255480] (4 PDB entries)
  8. 2502875Domain d5xqma_: 5xqm A: [341409]
    automated match to d2k1fa_

Details for d5xqma_

PDB Entry: 5xqm (more details)

PDB Description: nmr solution structure of smo1, sumo homologue in caenorhabditis elegans
PDB Compounds: (A:) Small ubiquitin-related modifier

SCOPe Domain Sequences for d5xqma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xqma_ d.15.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
maddaaqagdnaeyikikvvgqdsnevhfrvkygtsmaklkksyadrtgvavnslrflfd
grrindddtpktlemedddvievyqeqlgg

SCOPe Domain Coordinates for d5xqma_:

Click to download the PDB-style file with coordinates for d5xqma_.
(The format of our PDB-style files is described here.)

Timeline for d5xqma_: