Lineage for d5vmcb_ (5vmc B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3041801Species Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [341366] (4 PDB entries)
  8. 3041802Domain d5vmcb_: 5vmc B: [341407]
    Other proteins in same PDB: d5vmca_, d5vmcc_, d5vmce_
    automated match to d5bnyf_
    complexed with nag; mutant

Details for d5vmcb_

PDB Entry: 5vmc (more details), 2.15 Å

PDB Description: influenza hemagglutinin h1 mutant dh1 in complex with 6'sln
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d5vmcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vmcb_ h.3.1.0 (B:) automated matches {Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyse

SCOPe Domain Coordinates for d5vmcb_:

Click to download the PDB-style file with coordinates for d5vmcb_.
(The format of our PDB-style files is described here.)

Timeline for d5vmcb_: