Lineage for d1idoa_ (1ido A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864111Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1864112Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 1864113Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 1864126Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species)
  7. 1864127Species Human (Homo sapiens) [TaxId:9606] [53309] (12 PDB entries)
  8. 1864130Domain d1idoa_: 1ido A: [34139]
    complexed with mg

Details for d1idoa_

PDB Entry: 1ido (more details), 1.7 Å

PDB Description: i-domain from integrin cr3, mg2+ bound
PDB Compounds: (A:) integrin

SCOPe Domain Sequences for d1idoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1idoa_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
lrek

SCOPe Domain Coordinates for d1idoa_:

Click to download the PDB-style file with coordinates for d1idoa_.
(The format of our PDB-style files is described here.)

Timeline for d1idoa_: