Lineage for d5vmcf_ (5vmc F:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2267706Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2267707Protein automated matches [254645] (23 species)
    not a true protein
  7. 2267759Species Influenza a virus (strain a/brevig mission/1/1918 h1n1) [TaxId:88776] [341366] (4 PDB entries)
  8. 2267762Domain d5vmcf_: 5vmc F: [341386]
    Other proteins in same PDB: d5vmca_, d5vmcc_, d5vmce_
    automated match to d5bnyf_
    complexed with bma, gal, nag, sia; mutant

Details for d5vmcf_

PDB Entry: 5vmc (more details), 2.15 Å

PDB Description: influenza hemagglutinin h1 mutant dh1 in complex with 6'sln
PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d5vmcf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vmcf_ h.3.1.0 (F:) automated matches {Influenza a virus (strain a/brevig mission/1/1918 h1n1) [TaxId: 88776]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypkys

SCOPe Domain Coordinates for d5vmcf_:

Click to download the PDB-style file with coordinates for d5vmcf_.
(The format of our PDB-style files is described here.)

Timeline for d5vmcf_: