SCOPe 2.08: Domain d5vmgb_: 5vmg B:

Lineage for d5vmgb_ (5vmg B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [341366] (4 PDB entries)

8. Domain d5vmgb_: 5vmg B: [341381]
   Other proteins in same PDB: d5vmga_, d5vmgc_, d5vmge_
   automated match to d5bnyf_
   complexed with nag; mutant

Details for d5vmgb_

PDB Entry: 5vmg, 2.45 Å

PDB Description: influenza hemagglutinin h1 mutant dh1e in complex with 6'sln

PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d5vmgb_:

Sequence; same for both SEQRES and ATOM records:

>d5vmgb_ h.3.1.0 (B:) automated matches {Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyse

Timeline for d5vmgb_:

• d5vmgb_ first appeared in SCOPe 2.06
  
• d5vmgb_ appears in SCOPe 2.07