Lineage for d1oaka_ (1oak A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183302Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 183303Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 183304Family c.62.1.1: Integrin A (or I) domain [53301] (7 proteins)
  6. 183345Protein von Willebrand factor A1 domain [53306] (1 species)
  7. 183346Species Human (Homo sapiens) [TaxId:9606] [53307] (6 PDB entries)
  8. 183349Domain d1oaka_: 1oak A: [34138]
    Other proteins in same PDB: d1oakh1, d1oakh2, d1oakl1, d1oakl2

Details for d1oaka_

PDB Entry: 1oak (more details), 2.2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain in complex with the function blocking nmc-4 fab

SCOP Domain Sequences for d1oaka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaka_ c.62.1.1 (A:) von Willebrand factor A1 domain {Human (Homo sapiens)}
mycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgshayi
glkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasqe
pqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleqq
rdeivsylcdlapeap

SCOP Domain Coordinates for d1oaka_:

Click to download the PDB-style file with coordinates for d1oaka_.
(The format of our PDB-style files is described here.)

Timeline for d1oaka_: