Lineage for d5vksa_ (5vks A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052191Species Human rotavirus a [TaxId:10941] [187643] (6 PDB entries)
  8. 2052197Domain d5vksa_: 5vks A: [341375]
    automated match to d2dwra_
    complexed with fuc, gal, glc, gol, nag, so4

Details for d5vksa_

PDB Entry: 5vks (more details), 1.94 Å

PDB Description: crystal structure of p[19] rotavirus vp8* complexed with lnfpi
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d5vksa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vksa_ b.29.1.0 (A:) automated matches {Human rotavirus a [TaxId: 10941]}
vldgpyqpvtfkppndywilinsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
ttdysttsnlneisvttyaefyiiprsqeskcteyintgl

SCOPe Domain Coordinates for d5vksa_:

Click to download the PDB-style file with coordinates for d5vksa_.
(The format of our PDB-style files is described here.)

Timeline for d5vksa_: