Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (53 species) not a true protein |
Species Human rotavirus a [TaxId:10941] [187643] (6 PDB entries) |
Domain d5vksa_: 5vks A: [341375] automated match to d2dwra_ complexed with fuc, gal, glc, gol, nag, so4 |
PDB Entry: 5vks (more details), 1.94 Å
SCOPe Domain Sequences for d5vksa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vksa_ b.29.1.0 (A:) automated matches {Human rotavirus a [TaxId: 10941]} vldgpyqpvtfkppndywilinsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna ttdysttsnlneisvttyaefyiiprsqeskcteyintgl
Timeline for d5vksa_: