Lineage for d1auq__ (1auq -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25985Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 25986Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 25987Family c.62.1.1: Integrin A (or I) domain [53301] (6 proteins)
  6. 26021Protein von Willebrand factor A1 domain [53306] (1 species)
  7. 26022Species Human (Homo sapiens) [TaxId:9606] [53307] (3 PDB entries)
  8. 26024Domain d1auq__: 1auq - [34137]

Details for d1auq__

PDB Entry: 1auq (more details), 2.3 Å

PDB Description: a1 domain of von willebrand factor

SCOP Domain Sequences for d1auq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auq__ c.62.1.1 (-) von Willebrand factor A1 domain {Human (Homo sapiens)}
disepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavve
yhdgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasri
alllmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvl
ssvdeleqqrdeivsylcdlapeapppt

SCOP Domain Coordinates for d1auq__:

Click to download the PDB-style file with coordinates for d1auq__.
(The format of our PDB-style files is described here.)

Timeline for d1auq__: