SCOPe 2.01: Domain d1fnsa_: 1fns A:

Lineage for d1fnsa_ (1fns A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)

6. Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53307] (9 PDB entries)

8. Domain d1fnsa_: 1fns A: [34136]
   Other proteins in same PDB: d1fnsh1, d1fnsh2, d1fnsl1, d1fnsl2
   mutant

Details for d1fnsa_

PDB Entry: 1fns, 2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4

PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d1fnsa_:

Sequence; same for both SEQRES and ATOM records:

>d1fnsa_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
mycsrlldlvflldgssrlseaefevlkafvvdmmerlrvsqkwvrvavveyhdgshayi
glkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasqe
pqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleqq
rdeivsylcdlapeap

Timeline for d1fnsa_:

• d1fnsa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fnsa_ appears in SCOP 1.75
  
• d1fnsa_ appears in SCOPe 2.02
  
• d1fnsa_ appears in the current release, SCOPe 2.08, called d1fnsa1