Lineage for d1fnsa_ (1fns A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704292Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 704293Superfamily c.62.1: vWA-like [53300] (5 families) (S)
  5. 704294Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)
  6. 704387Protein von Willebrand factor A1 domain, vWA1 [53306] (1 species)
  7. 704388Species Human (Homo sapiens) [TaxId:9606] [53307] (9 PDB entries)
  8. 704390Domain d1fnsa_: 1fns A: [34136]
    Other proteins in same PDB: d1fnsh1, d1fnsh2, d1fnsl1, d1fnsl2
    mutant

Details for d1fnsa_

PDB Entry: 1fns (more details), 2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4
PDB Compounds: (A:) von willebrand factor

SCOP Domain Sequences for d1fnsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnsa_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
mycsrlldlvflldgssrlseaefevlkafvvdmmerlrvsqkwvrvavveyhdgshayi
glkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasqe
pqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleqq
rdeivsylcdlapeap

SCOP Domain Coordinates for d1fnsa_:

Click to download the PDB-style file with coordinates for d1fnsa_.
(The format of our PDB-style files is described here.)

Timeline for d1fnsa_: