Lineage for d5topb_ (5top B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244965Protein automated matches [190161] (23 species)
    not a true protein
  7. 2245030Species Escherichia coli [TaxId:562] [187306] (66 PDB entries)
  8. 2245081Domain d5topb_: 5top B: [341355]
    automated match to d4pm5a_
    complexed with 7g4, jsc, jse, k, ru

Details for d5topb_

PDB Entry: 5top (more details), 1.18 Å

PDB Description: atomic resolution x-ray crystal structure of a ruthenocene conjugated beta-lactam antibiotic in complex with ctx-m-14 s70g beta-lactamase
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5topb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5topb_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
avqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqsetqk
qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
twlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpqq
naesrrdvlasaariiaegl

SCOPe Domain Coordinates for d5topb_:

Click to download the PDB-style file with coordinates for d5topb_.
(The format of our PDB-style files is described here.)

Timeline for d5topb_: