Lineage for d1ao3a_ (1ao3 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.62: Integrin A (or I) domain [53299] (1 superfamily) Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) 
Family c.62.1.1: Integrin A (or I) domain [53301] (6 proteins) Protein von Willebrand factor A3 domain [53304] (1 species) Species Human (Homo sapiens) [TaxId:9606] [53305] (2 PDB entries) 
Domain d1ao3a_: 1ao3 A: [34134]
Details for d1ao3a_
PDB Entry: 1ao3 (more details), 2.2 Å
PDB Description: a3 domain of von willebrand factor
SCOP Domain Sequences for d1ao3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ao3a_ c.62.1.1 (A:) von Willebrand factor A3 domain {Human (Homo sapiens)}
csqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvpw
nvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvsv
dsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlgn
sflhklc
SCOP Domain Coordinates for d1ao3a_:
Click to download the PDB-style file with coordinates for d1ao3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ao3a_:
- d1ao3a_ appears in SCOP 1.57
- d1ao3a_ appears in the current release, SCOPe 2.08
View in 3D
