Lineage for d1ao3a_ (1ao3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892340Protein von Willebrand factor A3 domain, vWA3 [53304] (1 species)
  7. 2892341Species Human (Homo sapiens) [TaxId:9606] [53305] (3 PDB entries)
  8. 2892344Domain d1ao3a_: 1ao3 A: [34134]

Details for d1ao3a_

PDB Entry: 1ao3 (more details), 2.2 Å

PDB Description: a3 domain of von willebrand factor
PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d1ao3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ao3a_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]}
csqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvpw
nvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvsv
dsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlgn
sflhklc

SCOPe Domain Coordinates for d1ao3a_:

Click to download the PDB-style file with coordinates for d1ao3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ao3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ao3b_