Lineage for d1atzb_ (1atz B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25985Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 25986Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 25987Family c.62.1.1: Integrin A (or I) domain [53301] (6 proteins)
  6. 26026Protein von Willebrand factor A3 domain [53304] (1 species)
  7. 26027Species Human (Homo sapiens) [TaxId:9606] [53305] (2 PDB entries)
  8. 26029Domain d1atzb_: 1atz B: [34133]

Details for d1atzb_

PDB Entry: 1atz (more details), 1.8 Å

PDB Description: human von willebrand factor a3 domain

SCOP Domain Sequences for d1atzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1atzb_ c.62.1.1 (B:) von Willebrand factor A3 domain {Human (Homo sapiens)}
dcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvp
wnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvs
vdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlg
nsflhklcs

SCOP Domain Coordinates for d1atzb_:

Click to download the PDB-style file with coordinates for d1atzb_.
(The format of our PDB-style files is described here.)

Timeline for d1atzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1atza_