Lineage for d1atza_ (1atz A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183302Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 183303Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 183304Family c.62.1.1: Integrin A (or I) domain [53301] (7 proteins)
  6. 183353Protein von Willebrand factor A3 domain [53304] (1 species)
  7. 183354Species Human (Homo sapiens) [TaxId:9606] [53305] (3 PDB entries)
  8. 183355Domain d1atza_: 1atz A: [34132]

Details for d1atza_

PDB Entry: 1atz (more details), 1.8 Å

PDB Description: human von willebrand factor a3 domain

SCOP Domain Sequences for d1atza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain {Human (Homo sapiens)}
qpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvpwnv
vpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvsvds
vdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlgnsf
lhkl

SCOP Domain Coordinates for d1atza_:

Click to download the PDB-style file with coordinates for d1atza_.
(The format of our PDB-style files is described here.)

Timeline for d1atza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1atzb_