Lineage for d5oria2 (5ori A:196-387)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013466Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2013467Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2013840Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2013841Protein automated matches [254493] (6 species)
    not a true protein
  7. 2013842Species Capra hircus [TaxId:9925] [341296] (3 PDB entries)
  8. 2013847Domain d5oria2: 5ori A:196-387 [341317]
    automated match to d3uiva1

Details for d5oria2

PDB Entry: 5ori (more details), 1.94 Å

PDB Description: structure of caprine serum albumin in orthorhombic crystal system
PDB Compounds: (A:) Albumin

SCOPe Domain Sequences for d5oria2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oria2 a.126.1.0 (A:196-387) automated matches {Capra hircus [TaxId: 9925]}
rlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkvhkecchgdllecadd
radlakyicdhqdtlssklkeccdkpvlekshciaeidkdavpenlppltadfaedkevc
knyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledccakedphacyatvfdk
lkhlvdepqnli

SCOPe Domain Coordinates for d5oria2:

Click to download the PDB-style file with coordinates for d5oria2.
(The format of our PDB-style files is described here.)

Timeline for d5oria2: