SCOPe 2.06: Domain d5ot0a_: 5ot0 A:

Lineage for d5ot0a_ (5ot0 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
   consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
   Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
   Domain 2 has parallel beta-sheet of 4 strands, order 1234

4. Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families)

5. Family c.88.1.0: automated matches [191606] (1 protein)
   not a true family

6. Protein automated matches [191105] (4 species)
   not a true protein

7. Species Thermococcus kodakarensis [TaxId:69014] [341313] (1 PDB entry)

8. Domain d5ot0a_: 5ot0 A: [341315]
   automated match to d1wlsa_
   complexed with edo, pg4, po4

Details for d5ot0a_

PDB Entry: 5ot0, 2.18 Å

PDB Description: the thermostable l-asparaginase from thermococcus kodakarensis

PDB Compounds: (A:) L-asparaginase

SCOPe Domain Sequences for d5ot0a_:

Sequence; same for both SEQRES and ATOM records:

>d5ot0a_ c.88.1.0 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
mkllvlgtggtiasaktemgykaalsaddilqlagirredgakietrdilnldstliqpe
dwvtigravfeafdeydgivithgtdtlaytssalsfmirnppipvvltgsmlpitepns
daprnlrtaltfarkgfpgiyvafmdkimlgtrvskvhslglnafqsinypdiayvkgde
vlvrhkprigngeplfdpeldpnvvhirltpglspevlravaratdgivlegygaggipy
rgrnllevvsetarekpvvmttqalyggvdltryevgrraleagvipagdmtkeatltkl
mwalghtrdleeirkimerniageitgs

Timeline for d5ot0a_:

• d5ot0a_ is new in SCOPe 2.06-stable
  
• d5ot0a_ appears in SCOPe 2.07
  
• d5ot0a_ appears in the current release, SCOPe 2.08