SCOPe 2.06: Domain d5o44e_: 5o44 E:

Lineage for d5o44e_ (5o44 E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (12 species)
   not a true protein

7. Species Musca domestica [TaxId:7370] [341246] (1 PDB entry)

8. Domain d5o44e_: 5o44 E: [341312]
   Other proteins in same PDB: d5o44d_, d5o44f_
   automated match to d3wwqa_
   complexed with mg, so4

Details for d5o44e_

PDB Entry: 5o44, 3.14 Å

PDB Description: crystal structure of unbranched mixed tri-ubiquitin chain containing k48 and k63 linkages.

PDB Compounds: (E:) Ubiquitin

SCOPe Domain Sequences for d5o44e_:

Sequence; same for both SEQRES and ATOM records:

>d5o44e_ d.15.1.1 (E:) automated matches {Musca domestica [TaxId: 7370]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagcqledgrtlsdyn
iqrestlhlvlrlrgg

Timeline for d5o44e_:

• d5o44e_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-10
  
• d5o44e_ appears in the current release, SCOPe 2.07