![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (12 species) not a true protein |
![]() | Species Musca domestica [TaxId:7370] [341246] (1 PDB entry) |
![]() | Domain d5o44e_: 5o44 E: [341312] Other proteins in same PDB: d5o44d_, d5o44f_ automated match to d3wwqa_ complexed with mg, so4 |
PDB Entry: 5o44 (more details), 3.14 Å
SCOPe Domain Sequences for d5o44e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o44e_ d.15.1.1 (E:) automated matches {Musca domestica [TaxId: 7370]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagcqledgrtlsdyn iqrestlhlvlrlrgg
Timeline for d5o44e_: