Lineage for d5otbb3 (5otb B:388-583)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013466Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2013467Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2013840Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2013841Protein automated matches [254493] (6 species)
    not a true protein
  7. 2013842Species Capra hircus [TaxId:9925] [341296] (3 PDB entries)
  8. 2013854Domain d5otbb3: 5otb B:388-583 [341302]
    automated match to d1n5ua3
    complexed with peg, pge, pro

Details for d5otbb3

PDB Entry: 5otb (more details), 2.5 Å

PDB Description: structure of caprine serum albumin in p1 space group
PDB Compounds: (B:) Albumin

SCOPe Domain Sequences for d5otbb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5otbb3 a.126.1.0 (B:388-583) automated matches {Capra hircus [TaxId: 9925]}
kkncelfekhgeygfqnalivrytrkapqvstptlveisrslgkvgtkccakpesermpc
tedylslilnrlcvlhektpvsekvtkccteslvnrrpcfsdltldetyvpkpfdgesft
fhadictlpdtekqikkqtalvellkhkpkatdeqlktvmenfvafvdkccaaddkegcf
llegpklvastqaala

SCOPe Domain Coordinates for d5otbb3:

Click to download the PDB-style file with coordinates for d5otbb3.
(The format of our PDB-style files is described here.)

Timeline for d5otbb3: