Class a: All alpha proteins [46456] (289 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (6 species) not a true protein |
Species Capra hircus [TaxId:9925] [341296] (3 PDB entries) |
Domain d5otbb3: 5otb B:388-583 [341302] automated match to d1n5ua3 complexed with peg, pge, pro |
PDB Entry: 5otb (more details), 2.5 Å
SCOPe Domain Sequences for d5otbb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5otbb3 a.126.1.0 (B:388-583) automated matches {Capra hircus [TaxId: 9925]} kkncelfekhgeygfqnalivrytrkapqvstptlveisrslgkvgtkccakpesermpc tedylslilnrlcvlhektpvsekvtkccteslvnrrpcfsdltldetyvpkpfdgesft fhadictlpdtekqikkqtalvellkhkpkatdeqlktvmenfvafvdkccaaddkegcf llegpklvastqaala
Timeline for d5otbb3: