SCOPe 2.03: Domain d1cqpb_: 1cqp B:

Lineage for d1cqpb_ (1cqp B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)

6. Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries)
   Uniprot P20701 153-334

8. Domain d1cqpb_: 1cqp B: [34128]
   complexed with lovastatin
   complexed with 803, mg

Details for d1cqpb_

PDB Entry: 1cqp, 2.6 Å

PDB Description: crystal structure analysis of the complex lfa-1 (cd11a) i-domain / lovastatin at 2.6 a resolution

PDB Compounds: (B:) antigen cd11a (p180)

SCOPe Domain Sequences for d1cqpb_:

Sequence; same for both SEQRES and ATOM records:

>d1cqpb_ c.62.1.1 (B:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
vi

Timeline for d1cqpb_:

• d1cqpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cqpb_ appears in SCOPe 2.02
  
• d1cqpb_ appears in SCOPe 2.04
  
• d1cqpb_ appears in the current release, SCOPe 2.08