SCOPe 2.08: Domain d5o96f2: 5o96 F:76-244

Lineage for d5o96f2 (5o96 F:76-244)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.0: automated matches [191557] (1 protein)
   not a true family

6. Protein automated matches [190961] (22 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:446] [341250] (2 PDB entries)

8. Domain d5o96f2: 5o96 F:76-244 [341262]
   Other proteins in same PDB: d5o96a1, d5o96b1, d5o96c1, d5o96d1, d5o96e1, d5o96f1, d5o96g1, d5o96h1
   automated match to d4e8ba2
   protein/RNA complex; complexed with sam

Details for d5o96f2

PDB Entry: 5o96, 2.3 Å

PDB Description: structure of the putative methyltransferase lpg2936 from legionella pneumophila in complex with the bound cofactor sam

PDB Compounds: (F:) Ribosomal RNA small subunit methyltransferase E

SCOPe Domain Sequences for d5o96f2:

Sequence; same for both SEQRES and ATOM records:

>d5o96f2 c.116.1.0 (F:76-244) automated matches {Legionella pneumophila [TaxId: 446]}
resplkihlaqaiskgermemvmqksaelgvacitplitercqvkidkekmakkmhqwln
iiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsktwrdypvqppdvalii
gpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaaggdl

Timeline for d5o96f2:

• d5o96f2 first appeared in SCOPe 2.06
  
• d5o96f2 appears in SCOPe 2.07