Lineage for d1zon__ (1zon -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.62: Integrin A (or I) domain [53299] (1 superfamily) Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) 
Family c.62.1.1: Integrin A (or I) domain [53301] (6 proteins) 
Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species) Species Human (Homo sapiens) [TaxId:9606] [53303] (6 PDB entries) 
Domain d1zon__: 1zon - [34126]
Details for d1zon__
PDB Entry: 1zon (more details), 2 Å
PDB Description: cd11a i-domain without bound cation
SCOP Domain Sequences for d1zon__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zon__ c.62.1.1 (-) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens)}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
v
SCOP Domain Coordinates for d1zon__:
Click to download the PDB-style file with coordinates for d1zon__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zon__:
- d1zon__ appears in SCOP 1.57
- d1zon__ appears in the current release, SCOPe 2.08, called d1zona_
View in 3D