Lineage for d5o44a_ (5o44 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2502019Protein automated matches [190118] (15 species)
    not a true protein
  7. 2502047Species House fly (Musca domestica) [TaxId:7370] [341246] (1 PDB entry)
  8. 2502048Domain d5o44a_: 5o44 A: [341247]
    Other proteins in same PDB: d5o44b_, d5o44c_, d5o44d_, d5o44f_
    automated match to d3wwqa_
    complexed with mg, so4

Details for d5o44a_

PDB Entry: 5o44 (more details), 3.14 Å

PDB Description: crystal structure of unbranched mixed tri-ubiquitin chain containing k48 and k63 linkages.
PDB Compounds: (A:) Ubiquitin

SCOPe Domain Sequences for d5o44a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o44a_ d.15.1.1 (A:) automated matches {House fly (Musca domestica) [TaxId: 7370]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagcqledgrtlsdyn
iqrestlhlvlrlrgg

SCOPe Domain Coordinates for d5o44a_:

Click to download the PDB-style file with coordinates for d5o44a_.
(The format of our PDB-style files is described here.)

Timeline for d5o44a_: