Lineage for d1lfab_ (1lfa B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378146Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1378147Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 1378148Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 1378211Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)
  7. 1378212Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries)
    Uniprot P20701 153-334
  8. 1378225Domain d1lfab_: 1lfa B: [34123]
    complexed with cl, mn

Details for d1lfab_

PDB Entry: 1lfa (more details), 1.8 Å

PDB Description: cd11a i-domain with bound mn++
PDB Compounds: (B:) cd11a

SCOPe Domain Sequences for d1lfab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lfab_ c.62.1.1 (B:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
vi

SCOPe Domain Coordinates for d1lfab_:

Click to download the PDB-style file with coordinates for d1lfab_.
(The format of our PDB-style files is described here.)

Timeline for d1lfab_: