Lineage for d1lfaa_ (1lfa A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25985Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 25986Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 25987Family c.62.1.1: Integrin A (or I) domain [53301] (6 proteins)
  6. 25999Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)
  7. 26000Species Human (Homo sapiens) [TaxId:9606] [53303] (6 PDB entries)
  8. 26001Domain d1lfaa_: 1lfa A: [34122]

Details for d1lfaa_

PDB Entry: 1lfa (more details), 1.8 Å

PDB Description: cd11a i-domain with bound mn++

SCOP Domain Sequences for d1lfaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lfaa_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens)}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
vie

SCOP Domain Coordinates for d1lfaa_:

Click to download the PDB-style file with coordinates for d1lfaa_.
(The format of our PDB-style files is described here.)

Timeline for d1lfaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lfab_