Lineage for d6eqib_ (6eqi B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024425Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
  8. 2024714Domain d6eqib_: 6eqi B: [341217]
    Other proteins in same PDB: d6eqia_
    automated match to d4nbxb_
    complexed with gol

Details for d6eqib_

PDB Entry: 6eqi (more details), 3.1 Å

PDB Description: structure of pink1 bound to ubiquitin
PDB Compounds: (B:) Nb696

SCOPe Domain Sequences for d6eqib_:

Sequence, based on SEQRES records: (download)

>d6eqib_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslklscttsgrpfstfdlawfrqapgkerefvsglrrggstfya
dsvsgrftisggstkntlylqmnslkpedtaiyycarsitgyglvdsashytiwgqgtqv
tvsshh

Sequence, based on observed residues (ATOM records): (download)

>d6eqib_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslklscttsgrpfstfdlawfrqapgkerefvsglrrggstfya
dsvsgrftisgtkntlylqmnslkpedtaiyycarsitgyglvdsashytiwgqgtqvtv
sshh

SCOPe Domain Coordinates for d6eqib_:

Click to download the PDB-style file with coordinates for d6eqib_.
(The format of our PDB-style files is described here.)

Timeline for d6eqib_: